3vopoqmqscwhdybm3lpx smart

Smart Bioscience

Saint Martin D’Hère, FR

Smart Bioscience is a French company specialized in custom peptide synthesis, peptide engineering and peptide analysis. Peptides are 100% made in France in the company facilities located in the Grenoble area. Smart Bioscience is a subdivisary of the worldwide renowned company Smartox Biotechnology for its expertise in animal venom research. Smartox Biotechnology offers compound libraries for screening, analytical services and synthetic peptide toxins in more than 40 countries to pharmaceutical, biotech and academic research laboratories. Smartox Biotechnology has developed an extensive expertise in peptide synthesis, engineering and analysis which is now accessible through Smart Bioscience to every scientist requiring peptide services.

Smart Bioscience offers quality, flexible and reliable services, focused on the satisfaction of our clients. Peptide synthesis services from the Smartox group have been cited in... Show more »

Smart Bioscience is a French company specialized in custom peptide synthesis, peptide engineering and peptide analysis. Peptides are 100% made in France in the company facilities located in the Grenoble area. Smart Bioscience is a subdivisary of the worldwide renowned company Smartox Biotechnology for its expertise in animal venom research. Smartox Biotechnology offers compound libraries for screening, analytical services and synthetic peptide toxins in more than 40 countries to pharmaceutical, biotech and academic research laboratories. Smartox Biotechnology has developed an extensive expertise in peptide synthesis, engineering and analysis which is now accessible through Smart Bioscience to every scientist requiring peptide services.

Smart Bioscience offers quality, flexible and reliable services, focused on the satisfaction of our clients. Peptide synthesis services from the Smartox group have been cited in various scientific publications and patents. Smart Bioscience supplies public, pharmaceutical and biotech laboratories, agroscience & cosmetic companies as well as CRO in antibody production for example. The company has already successfully synthesized peptides with up to 65 amino acids in acceptable quantity and purity, with up to 5 disulfide bridges, performed double labeling…

Recent Publications

  • Nature, Scientific reports (2016) TCTP contains a BH3-like domain, which instead of inhibiting, activates Bcl-xL
  • Biosensors and Bioelectronics (2016) Microfabricated biosensor for the simultaneous amperometric and luminescence detection and monitoring of Ochratoxin A
« Show less

Smart Bioscience has not listed any services.

Peptide Synthesis
Price on request

Simple and complex peptide synthesis - Express service - Made in France

From 2 to > 120 Amino Acids

Smart Bioscience has the expertise to synthesize peptides from 2 to 120 amino acids inclunding complex sequences in effective quantity and quality.

Up to > 99% purity rate

Smart Bioscience offers various... Show more »

Simple and complex peptide synthesis - Express service - Made in France

From 2 to > 120 Amino Acids

Smart Bioscience has the expertise to synthesize peptides from 2 to 120 amino acids inclunding complex sequences in effective quantity and quality.

Up to > 99% purity rate

Smart Bioscience offers various purity rates:

  • Desalted: not purified peptides but synthesis reagents are removed. Purity and mass are controlled
  • >80%: peptides are purified and the minimal purity guaranteed is 80%
  • >90%: peptides are purified and the minimal purity guaranteed is 90%
  • >95%: peptides are purified and the minimal purity guaranteed is 95%
  • Ultra-pure peptides: Smart Bioscience can supply peptides with a purity rate >99% determined on an ultra high resolutive 2.6µ column. This approach ensures a ultra high accurate peptide purity.

To define which peptide purity you need, please visit the section how to choose the peptide purity grade

From mg to g quantities

Smart Bioscience offers laboratory research peptide synthesis scale, from milligram up to gram.
Typical quantities offered by Smart Bioscience are:
- 4 mg
- 10 mg
- 50 mg
- Others upon request

Quantification of delivered peptides are given as Net Peptide Content (NPC) >90% rather than gross weight generally offered.

During the peptide synthesis process, peptides are in contact with TFA (trifluoroacetic acid) which form salts and can rapidly take an important part of the final gross weight. Atmospheric water also increase the gross weight of the peptide. Our quantification methods give us a good estimation of the peptide material quantity rather than a gross weight.

NPC >90% means that the given quantity contains more than 90% peptide material.

We do not sale salts, we sale peptide!

Solubility test included

Smart Bioscience tests the solubility of delivered peptides and describes the recommended condition in each certificate of analysis. This is included in the price !

Confidentiality

Our peptides are 100% produced in-house. Client's data are not shared with any subcontractors.

  • Peptide Catalog*

Smart Bioscience is developing a catalog of peptides, including histone peptides, defensin, CPP, AMP, enzyme substrates, RGD peptides, hormones, gel forming peptides, amyloid peptide, etc. Feel free to contact us if you are looking for a specific peptide.

hBD-2 - human beta-defensin 2

Human beta-defensin-2 (hBD-2), also known as skin-antimicrobial peptide 1 (SAP1) is a cysteine-rich cationic antimicrobial peptide of 41 amino acids. It was originally isolated from skin cells of psoriasis patients. hBD-2, which belongs to the defensin family, is implicated in the innate immunity thanks to its antimicrobial activity. Thus, β-defensins can play a role at the cutaneous level by limiting the use of antibiotics in severe burns and disease like psoriasis. Moreover, at the pulmonary level, defensins might be involved in the resorption of the infection in cases of cystic fibrosis.
hBD-2 is produced after stimulation of epithelial cells following their contact with some organisms like Gram-negative bacteria and Candida Albicans, fungus or cytokines such as TNF-alpha and IL-1 beta. This antimicrobial activity was shown to be microbicidal at concentrations greater than 1 µM and was lethal for E.Coli and pseudomonas (LD90 : 10 mg/mL) and Candida Albicans (LD90 : 25 mg/mL). Besides its antimicrobial activity, hBD-2 also exhibits proinflammatory properties as chemoattractants for memory T-cells, immature dendritic cells, mast cells and neutrophils.
hBD-2 has also demonstrated inhibitory activity of the voltage-gated potassium channel Kv1.3 at picomolar concentration. Kv1.3 are overexpressed by T-cells in case of autoimmune disorders.
Technical specifications

AA sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Disulfide bridges: Cys8-Cys37, Cys15-Cys30, Cys20-Cys38
Length (aa): 41
Formula: C188H305N55O50S6
Molecular Weight: 4328.22 g/mol
Appearance: white powder
CAS: NA
Source: synthetic
Purity rate: > 95%
Quantity: 0.1 mg (larger quantities available)

« Show less
Synthetic Chemistry
Price on request
Request a quote for more information about this service.
Chemistry and Materials
Price on request
Request a quote for more information about this service.
Ask A Question Find what you're looking for? If not, you can ask this lab a question:
2018-01-30 03:17:05 -0800

Net Promoter Score of 10 received for Peptide Synthesis.

Additional Ratings: satisfaction with deliverable: 10, satisfaction with timeliness: 10.
2017-10-09 10:50:56 -0700

Net Promoter Score of 10 received for Peptide Synthesis.

Additional Ratings: satisfaction with deliverable: 10, satisfaction with timeliness: 10.
2017-08-17 11:47:36 -0700

Net Promoter Score of 10 received for Peptide Synthesis.

Additional Ratings: satisfaction with deliverable: 8, satisfaction with timeliness: 10.

Be the first to endorse Smart Bioscience

Endorse this lab